CacheBy
Atlas Antibodies Anti-PARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PARS2 Antibody

상품 한눈에 보기

인간 PARS2 단백질을 인식하는 토끼 폴리클로날 항체입니다. 미토콘드리아 prolyl-tRNA synthetase 2를 표적으로 하며, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. 친화 정제된 고품질 항체로 신뢰성 있는 실험 결과를 제공합니다.

카탈로그번호
HPA028518-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028518-100 Anti-PARS2 Antibody, prolyl-tRNA synthetase 2, mitochondrial (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028518-25 Anti-PARS2 Antibody, prolyl-tRNA synthetase 2, mitochondrial (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PARS2 Antibody

Anti-PARS2 Antibody

Target: prolyl-tRNA synthetase 2, mitochondrial (putative)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PARS2.


Alternative Gene Names

  • DKFZp727A071

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein prolyl-tRNA synthetase 2, mitochondrial (putative)
Target Gene PARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVI
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000043572 (78%), Rat ENSRNOG00000007327 (78%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.