Atlas Antibodies Anti-PARN Antibody

상품 한눈에 보기

Human PARN 단백질을 표적으로 하는 토끼 폴리클로날 항체로, poly(A)-specific ribonuclease 검출에 적합합니다. WB 및 IHC 응용에 권장되며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에 반응합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006314-100 Anti-PARN Antibody, poly(A)-specific ribonuclease 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006314-25 Anti-PARN Antibody, poly(A)-specific ribonuclease 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: poly(A)-specific ribonuclease
Type: Polyclonal Antibody against Human PARN

Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody raised in rabbit against Human PARN (poly(A)-specific ribonuclease).

항목	내용
Target Protein	poly(A)-specific ribonuclease
Target Gene	PARN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGA

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet