CacheBy
Atlas Antibodies Anti-PARD6A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PARD6A Antibody

상품 한눈에 보기

Human PARD6A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. 세포 극성 조절 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041551-100 Anti-PARD6A Antibody, par-6 family cell polarity regulator alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041551-25 Anti-PARD6A Antibody, par-6 family cell polarity regulator alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PARD6A Antibody

Anti-PARD6A Antibody

Target: par-6 family cell polarity regulator alpha
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PARD6A.


Alternative Gene Names

PAR-6, PAR-6A, PAR6alpha, TAX40, TIP-40

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein par-6 family cell polarity regulator alpha
Target Gene PARD6A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
Verified Species Reactivity Human
Interspecies Identity Mouse (76%), Rat (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.