CacheBy
Atlas Antibodies Anti-PAPSS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PAPSS2 Antibody

상품 한눈에 보기

인간 PAPSS2 단백질을 인식하는 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합함. 토끼에서 생산된 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되어 연구용으로 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA071224-100 Anti-PAPSS2 Antibody, 3`-phosphoadenosine 5`-phosphosulfate synthase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071224-25 Anti-PAPSS2 Antibody, 3`-phosphoadenosine 5`-phosphosulfate synthase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PAPSS2 Antibody

Anti-PAPSS2 Antibody

Target Information

  • Target Protein: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • Target Gene: PAPSS2
  • Alternative Gene Name: ATPSK2

Product Description

Polyclonal antibody against human PAPSS2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000024899 (85%)
  • Rat ENSRNOG00000011068 (81%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications Immunocytochemistry (ICC)
Verified Species Human

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.