
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PALM3 Antibody
상품 한눈에 보기
인간 PALM3 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체입니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다.
- 카탈로그번호
- HPA056119-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056119-100 Anti-PALM3 Antibody, paralemmin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056119-25 Anti-PALM3 Antibody, paralemmin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PALM3 Antibody
Anti-PALM3 Antibody
Target Information
- Protein: Paralemmin 3
- Gene: PALM3
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIV
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PALM3.
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000047986 | 85% |
| Rat | ENSRNOG00000005729 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



