AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PALB2 Antibody
상품 한눈에 보기
Human PALB2 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, BRCA2 결합 단백질 연구에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 확보했으며, ICC 등 다양한 응용 분야에 사용 가능합니다.
- 카탈로그번호
- HPA057000-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057000-100 Anti-PALB2 Antibody, partner and localizer of BRCA2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057000-25 Anti-PALB2 Antibody, partner and localizer of BRCA2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PALB2 Antibody
Anti-PALB2 Antibody
Target: Partner and localizer of BRCA2
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human PALB2
Alternative Gene Names
- FANCN
- FLJ21816
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Partner and localizer of BRCA2 |
| Target Gene | PALB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Antigen Sequence:
YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000025126 | 41% |
| Mouse | ENSMUSG00000044702 | 39% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.