CacheBy
Atlas Antibodies Anti-PALLD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PALLD Antibody

상품 한눈에 보기

Human PALLD 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035905-100 Anti-PALLD Antibody, palladin, cytoskeletal associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035905-25 Anti-PALLD Antibody, palladin, cytoskeletal associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PALLD Antibody

Anti-PALLD Antibody

Target: palladin, cytoskeletal associated protein

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PALLD.

Alternative Gene Names

CGI-151, KIAA0992, SIH002

Open Datasheet (PDF)

Target Information

  • Target Protein: palladin, cytoskeletal associated protein
  • Target Gene: PALLD

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000058056 (83%)
  • Rat ENSRNOG00000010107 (83%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.