
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PAIP1 Antibody
상품 한눈에 보기
PAIP1 단백질을 인식하는 사람 유래 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 WB 실험에 적합하며, PrEST 항원으로 정제됨. 높은 종간 반응성(인간, 랫, 마우스) 확인됨. 안정한 PBS/glycerol buffer에 보존됨.
- 카탈로그번호
- HPA076187-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076187-100 Anti-PAIP1 Antibody, poly(A) binding protein interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076187-25 Anti-PAIP1 Antibody, poly(A) binding protein interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PAIP1 Antibody
Anti-PAIP1 Antibody
poly(A) binding protein interacting protein 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human PAIP1
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | poly(A) binding protein interacting protein 1 |
| Target Gene | PAIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000058580 (98%), Mouse ENSMUSG00000025451 (98%) |
Antigen Sequence:
GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



