CacheBy
Atlas Antibodies Anti-PAICS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PAICS Antibody

상품 한눈에 보기

Human PAICS 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation 수행으로 높은 신뢰성 확보. Human, Mouse, Rat 반응성 검증. PrEST 항원을 이용한 친화 정제 항체.

카탈로그번호
HPA041538-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041538-100 Anti-PAICS Antibody, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041538-25 Anti-PAICS Antibody, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PAICS Antibody

Anti-PAICS Antibody

Target: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Type: Polyclonal Antibody against Human PAICS


  • Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Independent validation (WB): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against Human PAICS.


Alternative Gene Names

ADE2H1, AIRC, PAIS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Target Gene PAICS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS

Species Reactivity

Verified Species Human, Mouse, Rat
Rat Ortholog ENSRNOG00000056398 (96%)
Mouse Ortholog ENSMUSG00000029247 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
IHC Orthogonal Tooltip
WB Independent Validation
WB Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.