
1 / 2
Atlas Antibodies Anti-PAICS Antibody
상품 한눈에 보기
Human PAICS 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation 수행으로 높은 신뢰성 확보. Human, Mouse, Rat 반응성 검증. PrEST 항원을 이용한 친화 정제 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAICS Antibody
Target: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Type: Polyclonal Antibody against Human PAICS
Recommended Applications
- Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Independent validation (WB): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human PAICS.
Alternative Gene Names
ADE2H1, AIRC, PAIS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase |
| Target Gene | PAICS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS |
Species Reactivity
| Verified Species | Human, Mouse, Rat |
|---|---|
| Rat Ortholog | ENSRNOG00000056398 (96%) |
| Mouse Ortholog | ENSMUSG00000029247 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




