
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PAF1 Antibody
상품 한눈에 보기
Human PAF1 단백질을 인식하는 Rabbit Polyclonal 항체로, RNA polymerase II 관련 인자 연구에 적합. Affinity purification 방식으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용 가능. Human, Mouse, Rat 반응성 확인됨.
- 카탈로그번호
- HPA043637-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043637-100 Anti-PAF1 Antibody, PAF1 homolog, Paf1/RNA polymerase II complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043637-25 Anti-PAF1 Antibody, PAF1 homolog, Paf1/RNA polymerase II complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PAF1 Antibody
Anti-PAF1 Antibody
Target: Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)
Recommended Applications
- Immunohistochemistry (IHC) 등 다양한 실험 응용 가능
Product Description
Polyclonal antibody against Human PAF1.
Alternative Gene Names
- F23149_1
- FLJ11123
- PD2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae) |
| Target Gene | PAF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000003437 | 100% |
| Rat | ENSRNOG00000019746 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



