CacheBy
Atlas Antibodies Anti-P2RY8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P2RY8 Antibody

상품 한눈에 보기

Human P2RY8 단백질을 인식하는 토끼 폴리클로날 항체로, 정제된 PrEST 항원을 사용하여 제작됨. IHC 등 응용에 적합하며 RNA-seq 데이터 기반 직교 검증 완료. PBS/glycerol 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003631-100 Anti-P2RY8 Antibody, purinergic receptor P2Y, G-protein coupled, 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003631-25 Anti-P2RY8 Antibody, purinergic receptor P2Y, G-protein coupled, 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P2RY8 Antibody

Anti-P2RY8 Antibody

Target: purinergic receptor P2Y, G-protein coupled, 8
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human P2RY8.

Alternative Gene Names

  • P2Y8

Open Datasheet

Target Information

항목 내용
Target Protein purinergic receptor P2Y, G-protein coupled, 8
Target Gene P2RY8
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000018003 29%
Mouse ENSMUSG00000021678 28%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.