CacheBy
Atlas Antibodies Anti-P2RY1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P2RY1 Antibody

상품 한눈에 보기

휴먼 P2RY1 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현의 정교한 검증에 적합. Rabbit 유래 IgG 항체이며, 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공. 인간, 랫, 마우스 간 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015577-100 Anti-P2RY1 Antibody, purinergic receptor P2Y, G-protein coupled, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015577-25 Anti-P2RY1 Antibody, purinergic receptor P2Y, G-protein coupled, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P2RY1 Antibody

Anti-P2RY1 Antibody

Target: purinergic receptor P2Y, G-protein coupled, 1
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human P2RY1.


Alternative Gene Names

  • P2Y1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein purinergic receptor P2Y, G-protein coupled, 1
Target Gene P2RY1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDT
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014232 (96%), Mouse ENSMUSG00000027765 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.