
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-P2RY1 Antibody
상품 한눈에 보기
휴먼 P2RY1 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현의 정교한 검증에 적합. Rabbit 유래 IgG 항체이며, 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공. 인간, 랫, 마우스 간 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA015577-100 Anti-P2RY1 Antibody, purinergic receptor P2Y, G-protein coupled, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015577-25 Anti-P2RY1 Antibody, purinergic receptor P2Y, G-protein coupled, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-P2RY1 Antibody
Anti-P2RY1 Antibody
Target: purinergic receptor P2Y, G-protein coupled, 1
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human P2RY1.
Alternative Gene Names
- P2Y1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | purinergic receptor P2Y, G-protein coupled, 1 |
| Target Gene | P2RY1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014232 (96%), Mouse ENSMUSG00000027765 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



