
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OXSM Antibody
상품 한눈에 보기
Human OXSM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증 및 재조합 발현 검증을 통해 신뢰성 확보. PrEST 항원으로 친화 정제된 고품질 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021300-100 Anti-OXSM Antibody, 3-oxoacyl-ACP synthase, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021300-25 Anti-OXSM Antibody, 3-oxoacyl-ACP synthase, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OXSM Antibody
Anti-OXSM Antibody
3-oxoacyl-ACP synthase, mitochondrial
Recommended Applications
- IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression. - ICC
Product Description
Polyclonal Antibody against Human OXSM
Alternative Gene Names
FASN2D, FLJ20604, KS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 3-oxoacyl-ACP synthase, mitochondrial |
| Target Gene | OXSM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000005993 (89%), Mouse ENSMUSG00000021786 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



