CacheBy
Atlas Antibodies Anti-OXNAD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OXNAD1 Antibody

상품 한눈에 보기

Human OXNAD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 확보하였으며, ICC 등 다양한 응용에 적합합니다. Human 반응성이 검증되어 연구용으로 최적화되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059160-100 Anti-OXNAD1 Antibody, oxidoreductase NAD-binding domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059160-25 Anti-OXNAD1 Antibody, oxidoreductase NAD-binding domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OXNAD1 Antibody

Anti-OXNAD1 Antibody

Target Protein: oxidoreductase NAD-binding domain containing 1
Supplier: Atlas Antibodies

면역세포화학 (ICC)

Product Description

Polyclonal antibody against Human OXNAD1.

Alternative Gene Names

  • MGC15763

Open Datasheet

Target Information

항목 내용
Target Protein oxidoreductase NAD-binding domain containing 1
Target Gene OXNAD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (89%), Mouse (85%)

Antigen Sequence:
SFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.