CacheBy
Atlas Antibodies Anti-OTULIN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OTULIN Antibody

상품 한눈에 보기

인간 OTULIN 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 제품입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051074-100 Anti-OTULIN Antibody, OTU deubiquitinase with linear linkage specificity 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051074-25 Anti-OTULIN Antibody, OTU deubiquitinase with linear linkage specificity 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OTULIN Antibody

Anti-OTULIN Antibody

OTU deubiquitinase with linear linkage specificity

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Orthogonal validation
  • Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human OTULIN

Alternative Gene Names

FAM105B, FLJ34884

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein OTU deubiquitinase with linear linkage specificity
Target Gene OTULIN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000046034 (93%), Rat ENSRNOG00000012017 (89%)

Antigen Sequence:
DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.