CacheBy
Atlas Antibodies Anti-OTOF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OTOF Antibody

상품 한눈에 보기

Human OTOF 단백질을 타겟으로 하는 토끼 폴리클로날 항체로, otoferlin 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, IHC 등 다양한 응용에 권장됩니다. DFNB6, DFNB9, FER1L2 유전자와 관련된 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012410-100 Anti-OTOF Antibody, otoferlin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012410-25 Anti-OTOF Antibody, otoferlin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OTOF Antibody

Anti-OTOF Antibody

Target Information

  • Target Protein: otoferlin
  • Target Gene: OTOF
  • Alternative Gene Names: DFNB6, DFNB9, FER1L2

Product Description

Polyclonal antibody against human OTOF, produced in rabbit. Recommended for use in immunohistochemistry (IHC) and related applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000009967): 98%
  • Mouse (ENSMUSG00000062372): 97%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.