
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OTOF Antibody
상품 한눈에 보기
Human OTOF 단백질을 타겟으로 하는 토끼 폴리클로날 항체로, otoferlin 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, IHC 등 다양한 응용에 권장됩니다. DFNB6, DFNB9, FER1L2 유전자와 관련된 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA012410-100 Anti-OTOF Antibody, otoferlin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012410-25 Anti-OTOF Antibody, otoferlin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OTOF Antibody
Anti-OTOF Antibody
Target Information
- Target Protein: otoferlin
- Target Gene: OTOF
- Alternative Gene Names: DFNB6, DFNB9, FER1L2
Product Description
Polyclonal antibody against human OTOF, produced in rabbit. Recommended for use in immunohistochemistry (IHC) and related applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000009967): 98%
- Mouse (ENSMUSG00000062372): 97%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Related Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



