CacheBy
Atlas Antibodies Anti-OSBPL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OSBPL3 Antibody

상품 한눈에 보기

인간 OSBPL3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 수행. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 높은 종간 일치율 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048401-100 Anti-OSBPL3 Antibody, oxysterol binding protein-like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048401-25 Anti-OSBPL3 Antibody, oxysterol binding protein-like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OSBPL3 Antibody

Anti-OSBPL3 Antibody

Target Protein: oxysterol binding protein-like 3
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC

Product Description

Polyclonal Antibody against Human OSBPL3


Alternative Gene Names

KIAA0704, ORP-3, ORP3, OSBP3

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein oxysterol binding protein-like 3
Target Gene OSBPL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029822 (87%), Rat ENSRNOG00000010011 (87%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.