Atlas Antibodies Anti-OSBPL1A Antibody

상품 한눈에 보기

Human OSBPL1A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043401-100 Anti-OSBPL1A Antibody, oxysterol binding protein-like 1A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043401-25 Anti-OSBPL1A Antibody, oxysterol binding protein-like 1A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-OSBPL1A Antibody

Anti-OSBPL1A Antibody

Target: Oxysterol binding protein-like 1A
Supplier: Atlas Antibodies

Recommended Applications

면역조직화학(IHC) 등 다양한 생명과학 연구 응용에 사용 가능

Product Description

Polyclonal antibody against Human OSBPL1A

Alternative Gene Names

ORP-1, ORP1, OSBPL1B

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000044252	83%
Rat	ENSRNOG00000054058	82%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.