CacheBy
Atlas Antibodies Anti-OSBPL1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OSBPL1A Antibody

상품 한눈에 보기

Human OSBPL1A 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040959-100 Anti-OSBPL1A Antibody, oxysterol binding protein-like 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040959-25 Anti-OSBPL1A Antibody, oxysterol binding protein-like 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OSBPL1A Antibody

Anti-OSBPL1A Antibody

Target: oxysterol binding protein-like 1A (OSBPL1A)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human OSBPL1A, designed for research applications such as immunohistochemistry (IHC).


Alternative Gene Names

ORP-1, ORP1, OSBPL1B


Target Information

  • Target Protein: oxysterol binding protein-like 1A
  • Target Gene: OSBPL1A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000044252 83%
Rat ENSRNOG00000054058 82%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.