
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OS9 Antibody
상품 한눈에 보기
Human OS9 단백질을 표적으로 하는 토끼 폴리클로날 항체로, ER lectin 단백질 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013694-100 Anti-OS9 Antibody, osteosarcoma amplified 9, endoplasmic reticulum lectin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013694-25 Anti-OS9 Antibody, osteosarcoma amplified 9, endoplasmic reticulum lectin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OS9 Antibody
Anti-OS9 Antibody
Target Protein: osteosarcoma amplified 9, endoplasmic reticulum lectin
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human OS9 protein. Suitable for immunohistochemistry and related applications.
Alternative Gene Names
ERLEC2, OS-9
Target Information
- Target Gene: OS9
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML - Verified Species Reactivity: Human
- Interspecies Identity:
- Rat ENSRNOG00000025570 (70%)
- Mouse ENSMUSG00000040462 (66%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Gently mix before use. Store as recommended by supplier. |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



