CacheBy
Atlas Antibodies Anti-ORC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ORC1 Antibody

상품 한눈에 보기

Human ORC1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, Human에 특이적으로 반응. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027439-100 Anti-ORC1 Antibody, origin recognition complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027439-25 Anti-ORC1 Antibody, origin recognition complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ORC1 Antibody

Anti-ORC1 Antibody

Target: Origin Recognition Complex Subunit 1 (ORC1)

Product Description

Polyclonal antibody against Human ORC1.
Alternative gene names: HSORC1, ORC1L, PARC1

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA

Verified Reactivity

  • Species: Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008841 (96%)
  • Mouse ENSMUSG00000028587 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Immunocytochemistry (ICC) and related immunoassays.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.