
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ORC1 Antibody
상품 한눈에 보기
Human ORC1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, Human에 특이적으로 반응. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027439-100 Anti-ORC1 Antibody, origin recognition complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027439-25 Anti-ORC1 Antibody, origin recognition complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ORC1 Antibody
Anti-ORC1 Antibody
Target: Origin Recognition Complex Subunit 1 (ORC1)
Product Description
Polyclonal antibody against Human ORC1.
Alternative gene names: HSORC1, ORC1L, PARC1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA
Verified Reactivity
- Species: Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000008841 (96%)
- Mouse ENSMUSG00000028587 (96%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Recommended Applications
Immunocytochemistry (ICC) and related immunoassays.
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



