CacheBy
Atlas Antibodies Anti-ORAI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ORAI1 Antibody

상품 한눈에 보기

Human ORAI1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, 고순도의 affinity purification 방식으로 정제되었습니다. Human에 특이적으로 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061823-100 Anti-ORAI1 Antibody, ORAI calcium release-activated calcium modulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061823-25 Anti-ORAI1 Antibody, ORAI calcium release-activated calcium modulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ORAI1 Antibody

Anti-ORAI1 Antibody

ORAI calcium release-activated calcium modulator 1

  • IHC (Orthogonal validation)
  • WB
  • ICC

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human ORAI1

Alternative Gene Names

CRACM1, FLJ14466, TMEM142A

Open Datasheet

Target Information

항목 내용
Target Protein ORAI calcium release-activated calcium modulator 1
Target Gene ORAI1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000001336 95%
Mouse ENSMUSG00000049686 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.