CacheBy
Atlas Antibodies Anti-OR51J1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OR51J1 Antibody

상품 한눈에 보기

Human OR51J1 단백질을 인식하는 Rabbit Polyclonal Antibody로, olfactory receptor 연구에 적합. PrEST 항원을 이용해 Affinity 정제됨. IHC 등 다양한 응용 가능. Human에 특이적으로 반응하며, glycerol buffer로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017605-100 Anti-OR51J1 Antibody, olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017605-25 Anti-OR51J1 Antibody, olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OR51J1 Antibody

Anti-OR51J1 Antibody

Target: olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene)

IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human OR51J1.

Alternative Gene Names

OR51J1P, OR51J2

Open Datasheet (PDF)

Target Information

  • Target Protein: olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene)
  • Target Gene: OR51J1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHGS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000050015 (26%)
  • Rat ENSRNOG00000024877 (26%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.