CacheBy
Thermo Fisher Scientific FAM13C Polyclonal Antibody
원본

Thermo Fisher Scientific FAM13C Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human FAM13C1 N-terminal region. Validated for Western blot (0.2–1 µg/mL). Supplied as liquid, 0.5 mg/mL, affinity purified. Stored at -20°C in PBS with 2% sucrose and 0.09% sodium azide. For research use only.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 09:20
Thermo Fisher Scientific PA544150 FAM13C Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원

Thermo Fisher Scientific · Thermo Fisher Scientific FAM13C Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested dilution: 0.2–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the N-terminal of human FAM13C1 (aa 110–159)
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Affinity Chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2606560

Product Specific Information

  • Peptide sequence:
    TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

  • Sequence homology:

    • Dog: 92%
    • Guinea Pig: 85%
    • Human: 100%
    • Mouse: 100%
    • Rabbit: 100%
    • Rat: 92%

Target Information

FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.