CacheBy
Atlas Antibodies Anti-OPLAH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OPLAH Antibody

상품 한눈에 보기

Human OPLAH 단백질을 인식하는 토끼 폴리클로날 항체로, 5-oxoprolinase(ATP-hydrolysing) 연구용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용 분야에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028260-100 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028260-25 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OPLAH Antibody

Anti-OPLAH Antibody

Target Information

  • Target Protein: 5-oxoprolinase (ATP-hydrolysing)
  • Target Gene: OPLAH
  • Alternative Gene Names: 5-Opase, OPLA

Product Description

Polyclonal antibody against human OPLAH protein.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY

Species Reactivity

Species Gene ID Sequence Identity
Human OPLAH Verified
Rat ENSRNOG00000011781 94%
Mouse ENSMUSG00000022562 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.