
1 / 2
Atlas Antibodies Anti-OPLAH Antibody
상품 한눈에 보기
Human OPLAH 단백질을 인식하는 토끼 폴리클로날 항체로, 5-oxoprolinase(ATP-hydrolysing) 연구용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용 분야에 사용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-OPLAH Antibody
Target Information
- Target Protein: 5-oxoprolinase (ATP-hydrolysing)
- Target Gene: OPLAH
- Alternative Gene Names: 5-Opase, OPLA
Product Description
Polyclonal antibody against human OPLAH protein.
Recommended for applications such as immunohistochemistry (IHC).
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY
Species Reactivity
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Human | OPLAH | Verified |
| Rat | ENSRNOG00000011781 | 94% |
| Mouse | ENSMUSG00000022562 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-OPN1SW Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OPN1SW Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OPLAH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OPLAH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OPALIN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.