CacheBy
Atlas Antibodies Anti-OGFOD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OGFOD2 Antibody

상품 한눈에 보기

인체 OGFOD2 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 특이적 정제되었습니다. 인간 반응성 검증 완료, 안정한 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040306-100 Anti-OGFOD2 Antibody, 2-oxoglutarate and iron-dependent oxygenase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040306-25 Anti-OGFOD2 Antibody, 2-oxoglutarate and iron-dependent oxygenase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OGFOD2 Antibody

Anti-OGFOD2 Antibody

2-oxoglutarate and iron-dependent oxygenase domain containing 2

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human OGFOD2

Alternative Gene Names

  • FLJ13491
  • FLJ37501

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein 2-oxoglutarate and iron-dependent oxygenase domain containing 2
Target Gene OGFOD2
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001081 (88%), Mouse ENSMUSG00000023707 (84%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.