CacheBy
Atlas Antibodies Anti-OGFOD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OGFOD2 Antibody

상품 한눈에 보기

인간 OGFOD2 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며 IgG 아이소타입을 가집니다. WB 및 IHC 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039448-100 Anti-OGFOD2 Antibody, 2-oxoglutarate and iron-dependent oxygenase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039448-25 Anti-OGFOD2 Antibody, 2-oxoglutarate and iron-dependent oxygenase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OGFOD2 Antibody

Anti-OGFOD2 Antibody

제품 개요

  • Target Protein: 2-oxoglutarate and iron-dependent oxygenase domain containing 2
  • Target Gene: OGFOD2
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Verified Species Reactivity: Human
  • Recommended Applications: IHC, WB

Alternative Gene Names

FLJ13491, FLJ37501

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    TALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCA

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000001081 88%
Mouse ENSMUSG00000023707 84%

Buffer Composition

Component Description
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

참고 자료

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.