CacheBy
Atlas Antibodies Anti-ODF4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ODF4 Antibody

상품 한눈에 보기

Human ODF4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal Validation을 통해 검증됨. Recombinant PrEST 항원으로 정제되었으며, 인간 시료에 반응. 연구용으로 정밀한 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072129-100 Anti-ODF4 Antibody, outer dense fiber of sperm tails 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072129-25 Anti-ODF4 Antibody, outer dense fiber of sperm tails 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ODF4 Antibody

Anti-ODF4 Antibody

Supplier: Atlas Antibodies

Overview

  • Target Protein: Outer dense fiber of sperm tails 4 (ODF4)
  • Description: Polyclonal antibody against Human ODF4
  • Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Alternative Gene Names

CT136, OPPO1

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK

Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000004225 (37%)
    • Mouse ENSMUSG00000032921 (35%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.