CacheBy
Atlas Antibodies Anti-OAZ2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OAZ2 Antibody

상품 한눈에 보기

Human OAZ2 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 사용해 친화 정제됨. 40% 글리세롤 기반 PBS 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047694-100 Anti-OAZ2 Antibody, ornithine decarboxylase antizyme 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047694-25 Anti-OAZ2 Antibody, ornithine decarboxylase antizyme 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OAZ2 Antibody

Anti-OAZ2 Antibody

Target: Ornithine decarboxylase antizyme 2 (OAZ2)
Type: Polyclonal Antibody against Human OAZ2

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human OAZ2 using a recombinant Protein Epitope Signature Tag (PrEST) antigen.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Ornithine decarboxylase antizyme 2
Target Gene OAZ2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000040652 (100%), Rat ENSRNOG00000015953 (98%)

Antigen Sequence:
PHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.