Atlas Antibodies Anti-NXPE2 Antibody

상품 한눈에 보기

Human NXPE2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공. RNA-seq 데이터 기반 단백질 발현 비교 분석에 적합. Human 시료에 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039876-100 Anti-NXPE2 Antibody, neurexophilin and PC-esterase domain family, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039876-25 Anti-NXPE2 Antibody, neurexophilin and PC-esterase domain family, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NXPE2 Antibody

Anti-NXPE2 Antibody

Target: neurexophilin and PC-esterase domain family, member 2 (NXPE2)
Type: Polyclonal Antibody against Human NXPE2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit against human NXPE2, validated for immunohistochemistry (IHC) and orthogonal comparison to RNA-seq data.

Alternative Gene Names

FAM55B, FLJ25224

Target Information

항목	내용
Target Protein	neurexophilin and PC-esterase domain family, member 2
Target Gene	NXPE2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KDHTKFSFNLENHIILNQGNIFKKYSHSETPLCPAVSPKETELRIKDIMEKLDQQ
Verified Species Reactivity	Human
Ortholog Identity	Mouse (47%), Rat (45%)