CacheBy
Atlas Antibodies Anti-NUS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUS1 Antibody

상품 한눈에 보기

Human NUS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027504-100 Anti-NUS1 Antibody, nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027504-25 Anti-NUS1 Antibody, nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUS1 Antibody

Anti-NUS1 Antibody

Target: Nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human NUS1.


Alternative Gene Names

C6orf68, MGC7199, NgBR, TANGO14

Open Datasheet


Target Information

항목 내용
Target Protein Nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Target Gene NUS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (94%), Rat (90%)

Antigen Sequence:
ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.