CacheBy
Atlas Antibodies Anti-NUP85 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUP85 Antibody

상품 한눈에 보기

Human NUP85 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. FLJ12549, NUP75 유전자 대체명으로 알려져 있으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 Rat, Mouse와 높은 상동성을 가집니다.

카탈로그번호
HPA062595-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062595-100 Anti-NUP85 Antibody, nucleoporin 85kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062595-25 Anti-NUP85 Antibody, nucleoporin 85kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUP85 Antibody

Anti-NUP85 Antibody

Target Protein: nucleoporin 85kDa
Supplier: Atlas Antibodies


  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NUP85.


Alternative Gene Names

  • FLJ12549
  • NUP75

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleoporin 85kDa
Target Gene NUP85
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000003673 89%
Mouse ENSMUSG00000020739 83%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.