CacheBy
Atlas Antibodies Anti-NUP85 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUP85 Antibody

상품 한눈에 보기

휴먼 NUP85 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인간에 대해 검증되었으며 Rat 및 Mouse와 높은 서열 유사성을 가짐. 40% glycerol/PBS buffer로 안정화 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061910-100 Anti-NUP85 Antibody, nucleoporin 85kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061910-25 Anti-NUP85 Antibody, nucleoporin 85kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUP85 Antibody

Anti-NUP85 Antibody

Target Protein: nucleoporin 85kDa
Supplier: Atlas Antibodies

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NUP85.

Alternative Gene Names

FLJ12549, NUP75

Open Datasheet

Target Information

항목 내용
Target Protein nucleoporin 85kDa
Target Gene NUP85
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003673 (89%), Mouse ENSMUSG00000020739 (83%)

Antigen Sequence:
ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.