Atlas Antibodies Anti-NUDT13 Antibody

상품 한눈에 보기

Human NUDT13 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040636-100 Anti-NUDT13 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040636-25 Anti-NUDT13 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human NUDT13 단백질을 인식하는 폴리클로날 항체입니다.
Host: Rabbit / Isotype: IgG
추천 응용 분야: IHC, ICC

Polyclonal Antibody against Human NUDT13

DKFZp586P2219

Target Protein: nudix (nucleoside diphosphate linked moiety X)-type motif 13
Target Gene: NUDT13
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
QDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWH
```

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand