CacheBy
Atlas Antibodies Anti-NUDT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT1 Antibody

상품 한눈에 보기

Human NUDT1 단백질을 인식하는 고품질 폴리클로날 항체로, Rabbit 유래 IgG 형식이며 IHC, WB, ICC 등 다양한 응용에 적합. Recombinant expression으로 검증된 신뢰성 높은 제품. Affinity purification으로 높은 특이성과 순도 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA012636-100 Anti-NUDT1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012636-25 Anti-NUDT1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT1 Antibody

Anti-NUDT1 Antibody

nudix (nucleoside diphosphate linked moiety X)-type motif 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human NUDT1

Alternative Gene Names

  • MTH1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 1
Target Gene NUDT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000001260 (83%), Mouse ENSMUSG00000036639 (81%)

Antigen Sequence

RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.