CacheBy
Atlas Antibodies Anti-NTF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTF3 Antibody

상품 한눈에 보기

Human NTF3(neurotrophin 3)을 인식하는 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존도를 가지며, 40% glycerol/PBS buffer로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA032001-100 Anti-NTF3 Antibody, neurotrophin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032001-25 Anti-NTF3 Antibody, neurotrophin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTF3 Antibody

Anti-NTF3 Antibody

Target Information

  • Target Protein: neurotrophin 3
  • Target Gene: NTF3
  • Alternative Gene Names: NGF2
  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human NTF3 (neurotrophin 3).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000019716 87%
Mouse ENSMUSG00000049107 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.