
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NSMCE1 Antibody
상품 한눈에 보기
Human NSMCE1 단백질을 타겟으로 한 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 Orthogonal 검증에 적합. PrEST 항원을 이용한 친화정제 방식으로 고순도 확보. Human에 반응성이 검증됨.
- 카탈로그번호
- HPA043091-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043091-100 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043091-25 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NSMCE1 Antibody
Anti-NSMCE1 Antibody
non-SMC element 1 homolog (S. cerevisiae)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NSMCE1
Alternative Gene Names
- NSE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | non-SMC element 1 homolog (S. cerevisiae) |
| Target Gene | NSMCE1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000030750 (92%), Rat ENSRNOG00000015218 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



