CacheBy
Atlas Antibodies Anti-NSMCE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSMCE1 Antibody

상품 한눈에 보기

Human NSMCE1 단백질을 타겟으로 한 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 Orthogonal 검증에 적합. PrEST 항원을 이용한 친화정제 방식으로 고순도 확보. Human에 반응성이 검증됨.

카탈로그번호
HPA043091-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043091-100 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043091-25 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSMCE1 Antibody

Anti-NSMCE1 Antibody

non-SMC element 1 homolog (S. cerevisiae)


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NSMCE1


Alternative Gene Names

  • NSE1

Open Datasheet


Target Information

항목 내용
Target Protein non-SMC element 1 homolog (S. cerevisiae)
Target Gene NSMCE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030750 (92%), Rat ENSRNOG00000015218 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.