원본

Atlas Antibodies Anti-NSMCE1 Antibody

상품 한눈에 보기

인간 NSMCE1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 오쏘고날 검증 제공. Rabbit에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조됨. Human 종에 반응하며 PrEST 항원 서열 기반.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041567-100 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041567-25 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

non-SMC element 1 homolog (S. cerevisiae)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human NSMCE1

NSE1

항목	내용
Target Protein	non-SMC element 1 homolog (S. cerevisiae)
Target Gene	NSMCE1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000030750 (92%), Rat ENSRNOG00000015218 (92%)

Antigen Sequence:
RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand