CacheBy
Atlas Antibodies Anti-NSMCE1 Antibody
원본

Atlas Antibodies Anti-NSMCE1 Antibody

상품 한눈에 보기

인간 NSMCE1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 오쏘고날 검증 제공. Rabbit에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조됨. Human 종에 반응하며 PrEST 항원 서열 기반.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041567-100 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041567-25 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSMCE1 Antibody

Anti-NSMCE1 Antibody

non-SMC element 1 homolog (S. cerevisiae)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human NSMCE1

Alternative Gene Names

NSE1

Open Datasheet

Target Information

항목 내용
Target Protein non-SMC element 1 homolog (S. cerevisiae)
Target Gene NSMCE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000030750 (92%), Rat ENSRNOG00000015218 (92%)

Antigen Sequence:
RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.