
원본
Atlas Antibodies Anti-NSMCE1 Antibody
상품 한눈에 보기
인간 NSMCE1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 오쏘고날 검증 제공. Rabbit에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조됨. Human 종에 반응하며 PrEST 항원 서열 기반.
- 카탈로그번호
- HPA041567-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041567-100 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041567-25 Anti-NSMCE1 Antibody, non-SMC element 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NSMCE1 Antibody
Anti-NSMCE1 Antibody
non-SMC element 1 homolog (S. cerevisiae)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NSMCE1
Alternative Gene Names
NSE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | non-SMC element 1 homolog (S. cerevisiae) |
| Target Gene | NSMCE1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000030750 (92%), Rat ENSRNOG00000015218 (92%) |
Antigen Sequence:
RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



