AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NSL1 Antibody
상품 한눈에 보기
Human NSL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 교차 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간, 쥐, 랫드에서 교차 반응성 확인됨.
- 카탈로그번호
- HPA053721-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053721-100 Anti-NSL1 Antibody, NSL1, MIS12 kinetochore complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053721-25 Anti-NSL1 Antibody, NSL1, MIS12 kinetochore complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NSL1 Antibody
Anti-NSL1 Antibody
NSL1, MIS12 kinetochore complex component
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human NSL1.
Alternative Gene Names
C1orf48, DC8, DKFZP566O1646, MIS14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NSL1, MIS12 kinetochore complex component |
| Target Gene | NSL1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000042286 (79%), Mouse ENSMUSG00000062510 (76%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.