CacheBy
Atlas Antibodies Anti-NRIP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRIP2 Antibody

상품 한눈에 보기

인간 NRIP2 단백질을 타깃으로 하는 폴리클로날 항체. 정제된 PrEST 항원 기반 친화 정제 방식 적용. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA039860-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039860-100 Anti-NRIP2 Antibody, nuclear receptor interacting protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039860-25 Anti-NRIP2 Antibody, nuclear receptor interacting protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRIP2 Antibody

Anti-NRIP2 Antibody

Target: Nuclear receptor interacting protein 2 (NRIP2)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human NRIP2


Alternative Gene Names

  • DKFZP761G1913

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear receptor interacting protein 2
Target Gene NRIP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (76%), Rat (75%)

Antigen Sequence:
LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.