CacheBy
Atlas Antibodies Anti-NRIP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRIP2 Antibody

상품 한눈에 보기

인간 NRIP2 단백질을 타깃으로 하는 폴리클로날 항체. 정제된 PrEST 항원 기반 친화 정제 방식 적용. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039860-100 Anti-NRIP2 Antibody, nuclear receptor interacting protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039860-25 Anti-NRIP2 Antibody, nuclear receptor interacting protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRIP2 Antibody

Anti-NRIP2 Antibody

Target: Nuclear receptor interacting protein 2 (NRIP2)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human NRIP2


Alternative Gene Names

  • DKFZP761G1913

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear receptor interacting protein 2
Target Gene NRIP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (76%), Rat (75%)

Antigen Sequence:
LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.