
Atlas Antibodies Anti-NRG1 Antibody
상품 한눈에 보기
Human NRG1(neuregulin 1)을 인식하는 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성이 검증되었으며, glycerol 기반 buffer로 안정화됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NRG1 Antibody
Target: neuregulin 1 (NRG1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human NRG1.
Alternative Gene Names
GGF, HGL, HRG, NDF, NRG1-IT2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neuregulin 1 |
| Target Gene | NRG1 |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010392 (97%), Mouse ENSMUSG00000062991 (73%) |
Antigen Information
Antigen Sequence (PrEST recombinant protein epitope):
KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




