Atlas Antibodies Anti-NRAP Antibody

상품 한눈에 보기

인간 NRAP(nebulin-related anchoring protein)을 인식하는 폴리클로날 항체. IHC 독립 검증을 통해 단백질 발현 확인 가능. 토끼 유래 IgG, PrEST 항원으로 정제. 인간 반응성 검증 완료, 40% 글리세롤 PBS 버퍼 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037954-100 Anti-NRAP Antibody, nebulin-related anchoring protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037954-25 Anti-NRAP Antibody, nebulin-related anchoring protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: nebulin-related anchoring protein (NRAP)
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human NRAP.

항목	내용
Target Protein	nebulin-related anchoring protein
Target Gene	NRAP
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000049134 (69%), Rat ENSRNOG00000016714 (69%)

Antigen Sequence:

TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand