CacheBy
Atlas Antibodies Anti-NPW Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPW Antibody

상품 한눈에 보기

Human NPW 단백질을 인식하는 Rabbit Polyclonal 항체로, 신경펩타이드 W 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능. 40% glycerol 기반 buffer로 안정적 보관 가능.

카탈로그번호
HPA064874-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064874-100 Anti-NPW Antibody, neuropeptide W 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064874-25 Anti-NPW Antibody, neuropeptide W 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPW Antibody

Anti-NPW Antibody

Target Information

  • Target Protein: neuropeptide W
  • Target Gene: NPW
  • Alternative Gene Names: PPL8

Product Description

Polyclonal antibody against Human NPW (neuropeptide W).
Recommended for use in immunohistochemistry (IHC) and related applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000012390): 41%
  • Mouse (ENSMUSG00000071230): 37%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Additional Resources

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.