CacheBy
Atlas Antibodies Anti-NPHS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPHS2 Antibody

상품 한눈에 보기

인간 NPHS2(podocin) 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 검증에 권장. Orthogonal validation으로 RNA-seq 데이터와 비교 가능. 친화 정제된 고품질 항체로 다양한 조직 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049486-100 Anti-NPHS2 Antibody, nephrosis 2, idiopathic, steroid-resistant (podocin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049486-25 Anti-NPHS2 Antibody, nephrosis 2, idiopathic, steroid-resistant (podocin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPHS2 Antibody

Anti-NPHS2 Antibody

Target: nephrosis 2, idiopathic, steroid-resistant (podocin)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NPHS2


Alternative Gene Names

  • PDCN
  • SRN1

Open Datasheet


Target Information

항목 내용
Target Protein nephrosis 2, idiopathic, steroid-resistant (podocin)
Target Gene NPHS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPK

Verified Species Reactivity

Human


Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000004030 88%
Mouse ENSMUSG00000026602 87%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.