CacheBy
Atlas Antibodies Anti-NPHS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPHS2 Antibody

상품 한눈에 보기

인간 NPHS2(podocin) 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 검증에 권장. Orthogonal validation으로 RNA-seq 데이터와 비교 가능. 친화 정제된 고품질 항체로 다양한 조직 연구에 적합.

카탈로그번호
HPA049486-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049486-100 Anti-NPHS2 Antibody, nephrosis 2, idiopathic, steroid-resistant (podocin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049486-25 Anti-NPHS2 Antibody, nephrosis 2, idiopathic, steroid-resistant (podocin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPHS2 Antibody

Anti-NPHS2 Antibody

Target: nephrosis 2, idiopathic, steroid-resistant (podocin)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NPHS2


Alternative Gene Names

  • PDCN
  • SRN1

Open Datasheet


Target Information

항목 내용
Target Protein nephrosis 2, idiopathic, steroid-resistant (podocin)
Target Gene NPHS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPK

Verified Species Reactivity

Human


Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000004030 88%
Mouse ENSMUSG00000026602 87%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.