AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOLC1 Antibody
상품 한눈에 보기
Human NOLC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. 주요 대체 유전자명은 KIAA0035, NOPP130, NOPP140, P130입니다.
- 카탈로그번호
- HPA037366-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037366-100 Anti-NOLC1 Antibody, nucleolar and coiled-body phosphoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037366-25 Anti-NOLC1 Antibody, nucleolar and coiled-body phosphoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOLC1 Antibody
Anti-NOLC1 Antibody
Target: nucleolar and coiled-body phosphoprotein 1 (NOLC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NOLC1.
Alternative Gene Names
KIAA0035, NOPP130, NOPP140, P130
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleolar and coiled-body phosphoprotein 1 |
| Target Gene | NOLC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000018704 (90%), Mouse ENSMUSG00000015176 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.