
원본
Thermo Fisher Scientific CCDC87 Polyclonal Antibody
상품 한눈에 보기
CCDC87 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 인간 시료에 반응하며, N-말단 펩타이드(aa 1-50)를 면역원으로 제작되었습니다. 액상 형태로 제공되며, -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 05:00
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA544709 CCDC87 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원
Thermo Fisher Scientific · Thermo Fisher Scientific CCDC87 Polyclonal Antibody
Applications
- Western Blot (WB): 0.2–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human CCDC87 (aa 1–50) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2576975 |
Product Specific Information
- Peptide sequence: MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL
- Sequence homology: Human: 100%
Target Information
CCDC87은 정자 형성과정에서 정상적인 정자 두부 형태 유지에 관여하며, 아크로좀 반응 및 정상적인 남성 생식능력에 필수적인 역할을 합니다. [UniProt]
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
