CacheBy
Atlas Antibodies Anti-BHMG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BHMG1 Antibody

상품 한눈에 보기

인간 BHMG1 단백질에 대한 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049521-100 Anti-BHMG1 Antibody, basic helix-loop-helix and HMG box domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049521-25 Anti-BHMG1 Antibody, basic helix-loop-helix and HMG box domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BHMG1 Antibody

Anti-BHMG1 Antibody

Target Protein: basic helix-loop-helix and HMG box domain containing 1
Target Gene: BHMG1


면역조직화학 (IHC) 등 다양한 생명과학 연구 응용에 적합


Product Description

Polyclonal Antibody against Human BHMG1
Open Datasheet


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Mouse ENSMUSG00000048038 29%
Rat ENSRNOG00000014093 24%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Safety Data Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 따라 최적의 농도와 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.