Atlas Antibodies Anti-BET1L Antibody

상품 한눈에 보기

인체 BET1L 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 제품입니다. Rabbit 유래 IgG 항체이며, 고순도 Affinity purified 방식으로 제조되었습니다.

카탈로그번호: HPA039819-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039819-100 Anti-BET1L Antibody, Bet1 golgi vesicular membrane trafficking protein-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039819-25 Anti-BET1L Antibody, Bet1 golgi vesicular membrane trafficking protein-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BET1L Antibody

Anti-BET1L Antibody

Bet1 golgi vesicular membrane trafficking protein-like

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data of corresponding target in high and low expression tissues.
Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human BET1L

Alternative Gene Names

GOLIM3
GS15

Open Datasheet

Target Information

항목	내용
Target Protein	Bet1 golgi vesicular membrane trafficking protein-like
Target Gene	BET1L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000013165 (91%), Mouse ENSMUSG00000110136 (91%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand