CacheBy
Atlas Antibodies Anti-BEAN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BEAN1 Antibody

상품 한눈에 보기

인간 BEAN1 단백질을 인식하는 토끼 폴리클로날 항체입니다. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 면역조직화학(IHC) 등 다양한 응용에 적합하며, 인간에 대한 검증된 반응성을 보유합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053851-100 Anti-BEAN1 Antibody, brain expressed, associated with NEDD4, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053851-25 Anti-BEAN1 Antibody, brain expressed, associated with NEDD4, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BEAN1 Antibody

Anti-BEAN1 Antibody

Target: brain expressed, associated with NEDD4, 1 (BEAN1)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human BEAN1.

Alternative Gene Names

SCA31

Open Datasheet

Target Information

  • Target Protein: brain expressed, associated with NEDD4, 1
  • Target Gene: BEAN1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000013301 68%
Mouse ENSMUSG00000031872 67%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.