CacheBy
Atlas Antibodies Anti-BCL9L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCL9L Antibody

상품 한눈에 보기

Human BCL9L 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증했습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049370-100 Anti-BCL9L Antibody, B-cell CLL/lymphoma 9-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049370-25 Anti-BCL9L Antibody, B-cell CLL/lymphoma 9-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCL9L Antibody

Anti-BCL9L Antibody

Target: B-cell CLL/lymphoma 9-like
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human BCL9L.

Alternative Gene Names

  • DLNB11

Open Datasheet (PDF)

Specifications

항목 내용
Target Protein B-cell CLL/lymphoma 9-like
Target Gene BCL9L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000063382 (98%), Rat ENSRNOG00000012420 (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

MSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQRGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAP

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.